ticketmob.com
Infinityparkatglendale.ticketmob.com has yet to be estimated by Alexa in terms of traffic and rank. Moreover, Infinityparkatglendale Ticketmob is slightly inactive on social media. There is still a lack of data on safety and reputation of this domain, so you should be very careful when browsing it.
Popular pages to visit on infinityparkatglendale.ticketmob.com
Rugbytown USA Glendale, CO 80246
Tickets are no longer available for today's ruby matches. Please visit our website for information about future matches - htt...
Saturday, April 23 12:00 PM - Gates Open 1:00 PM - Denver Barbarians vs. Belmont Shore Kids 12 and under FREE (ticket required)
Domain info
Location: | Germany |
Owned by: | On behalf of ticketmob.com owner (Identity Protection Service) |
Hosted by: | TEAM-INTERNET-PA |
Registered by: | Amazon Registrar, Inc. |
Subnetworks: | 185.53.177.31 |
More domains registered by Amazon Registrar, Inc.
Social Networks Activity
Facebook likes: | - |
Twitter mentions: | - |
Google pluses: | - |
LinkedIn mentions: | - |
Pinterest pins: | - |
StumbleUpon views: | - |